Everything below concerns c-Met signaling. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-11-28. Numbers and descriptions here follow the published literature rather than marketing material.
The full name often given is N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide. This name indicates a chain containing tyrosine, isoleucine, and a six-carbon amino acid derivative. Databases list a CAS Registry Number and a molecular formula for the compound. The peptide is small compared with proteins, and its structure allows it to be studied in cell cultures and animal models. Exact identity depends on the supplier's synthesis and purification process. Minor impurities can remain after synthesis.
Chemically, dihexa belongs to a broader group of angiotensin IV analogs. Researchers have modified the natural peptide to alter stability, binding, or distribution. Such changes can affect how the molecule behaves in experiments. The parent peptide angiotensin IV is involved in various physiological processes, but the modified analog is not identical to it. Public summaries sometimes blur the distinction between the natural fragment and the synthetic research compound. This distinction matters when interpreting study results.
Dihexa is a synthetic peptide that has been examined in laboratory and animal research. Its design is based on angiotensin IV, a naturally occurring peptide fragment produced in the body. The short name dihexa appears in scientific papers and online discussions, while the full chemical name describes a modified peptide chain. It is not a vitamin, mineral, or plant-derived compound. Suppliers typically present it as a research chemical rather than an approved medicine.
Dihexa is commonly handled as a lyophilized powder in laboratory settings. Storage at -20 °C in a desiccated, light-protected container is typical for peptides. Repeated freeze-thaw cycles can degrade the material, so aliquoting is often recommended. Aqueous solutions may be less stable than organic stocks and should be prepared fresh when possible. Personnel should follow institutional safety procedures and avoid uncontrolled exposure. Because human effects are not well characterized, handling precautions are prudent.
The proposed mechanism of dihexa centers on activation of the hepatocyte growth factor receptor, also called c-Met. Some studies suggest it acts as a mimetic of hepatocyte growth factor, promoting signaling pathways involved in synapse formation. Other work has explored interactions with angiotensin IV pathways, but the exact binding targets remain uncertain. Laboratory findings come mainly from cell cultures and animal models. Whether these mechanisms operate similarly in humans is an open question. Researchers have not established a single, universally accepted mechanism of action.
Identity and purity of dihexa samples are typically assessed with high-performance liquid chromatography and mass spectrometry. These methods can confirm molecular mass and estimate the presence of impurities. However, a certificate of analysis from a supplier is not a guarantee of independent testing. Researchers often require in-house verification before using a peptide in experiments. For solid samples, appearance, solubility, and chromatographic profile provide additional checks. Nuclear magnetic resonance may be used for structural confirmation when available.
| Property | Value | Notes |
|---|---|---|
| Common name | Dihexa | Shorthand used in research literature and supplier catalogs. |
| CAS Registry Number | 1401708-83-5 | Identifier assigned to the synthetic peptide. |
| Molecular formula | C27H44N4O5 | Reported formula; verify with a certificate of analysis. |
| Appearance | White to off-white powder | Typical form for lyophilized research peptides. |
| Typical storage | −20 °C or below, desiccated | Common condition for peptide stability. |
Purity and identity are usually assessed with reverse-phase high-performance liquid chromatography (RP-HPLC) and mass spectrometry. RP-HPLC separates components by hydrophobicity and can estimate peptide purity. Mass spectrometry confirms molecular mass and helps detect truncations or modifications. Some laboratories also use amino acid analysis or nuclear magnetic resonance for structural verification. A certificate of analysis from a supplier may list these results, but independent verification is often recommended for critical work.
Regulatory status varies by country, and dihexa is not widely approved as a medicine. In many jurisdictions it is treated as a research chemical, which limits its legal sale, possession, and human use. Products marketed online may lack verified purity or identity, and labels can be inaccurate. Researchers typically source material from suppliers that provide analytical documentation and follow institutional safety rules. Open questions remain about long-term stability, metabolite formation, and human pharmacokinetics.
Dihexa is a synthetic peptide studied in laboratory research. It is often described as an angiotensin IV analog or a hepatocyte growth factor mimetic. The compound emerged from investigations into angiotensin IV and its effects on neural pathways. It is not an approved medication, and controlled human trials are lacking. In literature and online forums, it is discussed mainly as a research chemical. Its chemical name appears as N-hexanoic-Tyr-Ile-(6-aminohexanoic amide) in some sources.
Development of dihexa has been linked to academic research on synaptogenesis, the formation of new synapses. Preclinical studies in rodents have examined its effects on learning and memory tasks. These studies are often cited in discussions about cognitive enhancement, but they do not establish safety or efficacy in humans. The compound's patent and commercial history is limited, and it is not widely available through pharmaceutical channels. Most information comes from animal models and in vitro experiments. Researchers continue to explore its basic biology rather than clinical applications.
Early laboratory work focused on its effects on synaptic connectivity and neuronal signaling. In cell and animal models, dihexa has been reported to promote the formation of new synapses, a process called synaptogenesis. These findings have generated interest in cognitive research, but the evidence base remains mostly preclinical. Human clinical trials with clear safety and efficacy endpoints are limited or absent in the public literature. Whether these effects translate to humans is an open question.
The proposed mechanism involves interaction with the hepatocyte growth factor (HGF) system and its receptor, c-Met. Dihexa is described in some studies as an HGF mimetic, meaning it may mimic or enhance HGF-mediated signaling. Activation of c-Met can influence cell growth, survival, and cytoskeletal remodeling, pathways that intersect with synaptic plasticity. However, the precise binding targets and downstream events for dihexa are not fully established, and alternative mechanisms have been suggested.
Dihexa is a synthetic peptide with the chemical name N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide, and it is structurally related to angiotensin IV, a naturally occurring peptide fragment. Researchers developed it as a modified analog intended to alter stability and activity relative to the parent peptide. Its short sequence and fatty acid chain distinguish it from many endogenous peptides, and published studies often describe it under the abbreviation dihexa. The compound is classified as a laboratory compound rather than an approved therapeutic in most jurisdictions.
Maurer, Maurer, ed. (1983) [1961]. Air Force Combat Units of World War II (PDF) (reprint ed.). Washington, DC: Office of Air Force History. ISBN 0-912799-02-1. LCCN 61060979. Archived from the original (PDF) on 20 December 2016. Retrieved 17 December 2016. Maurer, Maurer, ed. (1982) [1969]. Combat Squadrons of the Air Force, World War II (PDF) (reprint ed.). Washington, DC: Office of Air Force History. ISBN 0-405-12194-6. LCCN 70605402. OCLC 72556. Archived from the original (PDF) on 20 December 2016. Retrieved 17 December 2016.
== Nomenclature == This enzyme is a transferase, specifically one transferring phosphorus-containing groups (phosphotransferases) with a phosphate group as acceptor. The systematic name of this enzyme class is ATP:(d)GMP phosphotransferase. Other names in common use include"
In 1975, Domino's faced a lawsuit by Amstar Corporation, the maker of Domino Sugar, alleging trademark infringement and unfair competition. On May 2, 1980, the Fifth Circuit Court of Appeals in New Orleans found in favor of Domino's Pizza. During the lawsuit, Domino's opened fifteen new stores under the name Pizza Dispatch, while also converting other stores to the name.
The first submarine not relying on human power for propulsion was the French Plongeur (Diver), launched in 1863, which used compressed air at 1,200 kPa (180 psi). Narcís Monturiol designed the first air-independent and combustion-powered submarine, Ictíneo II, which was launched in Barcelona, Spain in 1864. The submarine became feasible as potential weapon with the development of the Whitehead torpedo, designed in 1866 by British engineer Robert Whitehead, the first practical self-propelled torpedo. The spar torpedo that had been developed earlier by the Confederate States Navy was considered to be impracticable, as it was believed to have sunk both its intended target, and H. L. Hunley, the submarine that deployed it. The Irish inventor John Philip Holland built a model submarine in 1876 and in 1878 demonstrated the Holland I prototype. This was followed by a number of unsuccessful designs. In 1896, he designed the Holland Type VI submarine, which used internal combustion engine power on the surface and electric battery power underwater. Launched on 17 May 1897 at Navy Lt. Lewis Nixon's Crescent Shipyard in Elizabeth, New Jersey, Holland VI was purchased by the United States Navy on 11 April 1900, becoming the Navy's first commissioned submarine, christened USS Holland. Discussions between the English clergyman and inventor George Garrett and the Swedish industrialist Thorsten Nordenfelt led to the first practical steam-powered submarines, armed with torpedoes and ready for military use.
Aspartic acid was first discovered in 1827 by Auguste-Arthur Plisson and Étienne-Ossian Henry by hydrolysis of asparagine, which had been isolated from asparagus juice in 1806. Their original method used lead hydroxide, but various other acids or bases are now more commonly used instead. There are two forms or enantiomers of aspartic acid. The name "aspartic acid" can refer to either enantiomer or a mixture of two. Of these two forms, only one, "L-aspartic acid", is directly incorporated into proteins. The biological roles of its counterpart, "D-aspartic acid" are more limited. Where enzymatic synthesis will produce one or the other, most chemical syntheses will produce both forms, "DL-aspartic acid", known as a racemic mixture. In the human body, aspartate is most frequently synthesized through the transamination of oxaloacetate. The biosynthesis of aspartate is facilitated by an aminotransferase enzyme: the transfer of an amine group from another molecule such as alanine or glutamine yields aspartate and an alpha-keto acid.
Sources: en.wikipedia.org
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
In jaundice owing to hemolysis (prehepatic, or hemolytic, jaundice), the pathophysiology is that overproduction of bilirubin from the extravascular or intravascular hemolysis overwhelms the capacity of the liver to excrete it. The bilirubin present in the plasma is largely unconjugated in this setting as they haven't been taken up and conjugated by the liver. In this case, total serum bilirubin increases while the ratio of direct bilirubin to indirect bilirubin remains 96 to 4 as up to 96%-99% of bilirubin in the bile are conjugated mentioned above. Although there were some studies that showed an inverse correlation between serum bilirubin level and prevalences of ischemic coronary artery disease, cancer mortality, or colorectal cancer in general population, the potential benefits of the chemopreventive function of bilirubin and their causative relations haven't been proved.
== Notable works == The Saxxy awards were given to a total of 33 winners, ranging from comedic or action shorts to extended short films across a variety of genres. Longer films produced with the software include Darkest Days, an hour-long jukebox musical based on Left 4 Dead 2, and Emesis Blue, a 108-minute psychological horror feature film based on Team Fortress 2.
== Early years == Rodrigo Roa Duterte was born on March 28, 1945, in Maasin, Leyte. His father was Vicente Gonzales Duterte (1911–1968), a Cebuano lawyer, and his mother, Soledad Gonzales Roa (1916–2012), was a schoolteacher from Cabadbaran, Agusan and a civic leader, of Chinese and Spanish mestizo descent. Duterte has said that his grandfather was Chinese and hailed from Xiamen in Fujian, China. Duterte has four siblings: Eleanor (born 1941/42), Emmanuel, Jocelyn (1948–2023) and Benjamin ("Bong", 1953–2026). Duterte's father was mayor of Danao, Cebu, and subsequently the provincial governor of (the then-undivided) Davao province. Rodrigo's cousin Ronald was mayor of Cebu City from 1983 to 1986. Ronald's father, Ramon Duterte, also held that position from 1957 to 1959. The Dutertes consider the Cebu-based political families of the Durano and the Almendras clan as relatives. Duterte also has relatives from the Roa clan in Leyte through his mother's side. Duterte's family lived in Maasin, and in his father's hometown in Danao, until he was four years old. Duterte was heavily influenced by his mother, who unlike Vicente was a staunch anti-Marcos activist, which led the young Duterte to have a divided opinion on the Marcoses. Duterte later said Marcos could have been the best president, but he was a dictator. The Dutertes initially moved to Mindanao in 1948 but still went back and forth to the Visayas until 1949. They finally settled in the Davao Region in 1950. Vicente worked as a lawyer engaged in private practice.
Sources: en.wikipedia.org
The King's College Criteria or the King's College Hospital criteria were devised in 1989 to determine if there were any early indices of poor prognosis in patients with acute liver failure. Acute liver failure is defined as the onset of encephalopathy (altered mental status) or coagulopathy (altered bleeding tendencies) within 26 weeks of a patient diagnosed with liver disease. Patients with hepatitis B acquired at birth, Wilson's disease and autoimmune hepatitis are included if their disease was identified within the past 26 weeks. These patients are very ill, and have a very high risk of dying of their illness without adequate treatment which may include liver transplantation. It is important that physicians find ways of identifying patients with acute liver failure early in their course who will do poorly, and may require liver transplantation. The King's College Criteria have consistently shown excellent operating characteristics for determining prognosis in these patients. As liver transplantation becomes a more accessible option for patients with acute liver failure, the King's College Criteria serve a role in determining which patients may require transplantation.
=== Local === By delivering drugs almost directly to the site of action, the risk of systemic side effects is reduced. Skin absorption (dermal absorption), for example, is to directly deliver drug to the skin and, hopefully, to the systemic circulation. However, skin irritation may result, and for some forms such as creams or lotions, the dosage is difficult to control. Upon contact with the skin, the drug penetrates into the dead stratum corneum and can afterwards reach the viable epidermis, the dermis, and the blood vessels.
Gold fingerprinting is a method used to identify and authenticate gold items by analyzing the unique composition of impurities or trace elements within the metal. While gold itself is an inert and relatively uniform element, gold found in natural or processed items often contains small amounts of other elements, such as silver or lead. These trace elements, which vary depending on the source and refining process, serve as a "fingerprint" for the gold. By comparing the elemental composition of a gold sample to databases of known sources, experts can determine where the gold was likely mined or processed. This technique is applied in fields such as archaeology, geology, and forensic science, as it provides insights into the provenance of historical artifacts, mined gold, or stolen items.
Sources: en.wikipedia.org
Dihexa is a synthetic peptide modeled on angiotensin IV. It is used in laboratory and animal research, not as an approved medicine. Human effects remain poorly characterized.
It is produced by chemical synthesis, not extracted from plants or animals. Its design is based on a naturally occurring peptide fragment. Suppliers sell it as a research chemical.
No, dihexa is a modified analog of angiotensin IV. The two share a structural relationship but differ in chemical details. Research on one does not automatically apply to the other.
Liquid chromatography–mass spectrometry is commonly used. It provides molecular mass and purity information. Other methods may include HPLC with ultraviolet detection.